PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_49C7C1976.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 207aa    MW: 22279.5 Da    PI: 8.4481
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_49C7C1976.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31.1e-32103159158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
  Traes_5BS_49C7C1976.2 103 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 159
                            69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-35101162IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.934102162IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.8E-27104159IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-23105127IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860107127IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-23136159IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MTSVADGVSG DHRADEQQQK QAAQGNQEEA PATSIGSQAM VATPATDYVT PYGHQEACHA  60
MQGQIVDPFY GSLYAAYGGQ PMMHPPMVGM HAAAIPLPTD AIEEPVYVNA KQYNAILRRR  120
QSRAKAESER KLIKGRKPYL HESRHQHALK RARGAGGRFL NAKSDDNEEH SDSSSKDKQN  180
GAAPRSSGQS SQSPKGATSA DKSGNHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-22102175174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0096240.0BT009624.1 Triticum aestivum clone wre1n.pk0143.h2:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237027.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_014758866.11e-115PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP16e-43NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLW5FLZ91e-152W5FLZ9_WHEAT; Uncharacterized protein
STRINGMLOC_52315.11e-139(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.25e-38nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]